HBA1, Mouse, Clone: 4F9, Abnova™

Catalog No.	Quantity
89-022-445	100 μg

Catalog No. 89-022-445 Supplier Abnova Corporation Supplier No. H00003039M02

Description

Mouse monoclonal antibody raised against a partial recombinant HBA1.

The human alpha globin gene cluster located on chromosome 16 spans about 30kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq]

Sequence: MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR

Specifications

• Antigen: HBA1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4F9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant HBA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: HBA1
• Gene Accession No.: NM_000558
• Gene Alias: HBH/HBA-T3
• Gene Symbols: HBA1
• Host Species: Mouse
• Immunogen: HBA1 (NP_000549, 33 a.a. ∼ 142 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 3039
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ