interleukin enhancer binding factor 2, 45kDa, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-168	50 μL

Catalog No. 89-004-168

Supplier: Abnova Corporation H00003608A01

Description

Mouse polyclonal antibody raised against a partial recombinant ILF2.

Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45kDa and 90kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90kDa protein and stimulates its ability to enhance gene expression. [provided by RefSeq

Sequence: PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH

Specifications

• Antigen: interleukin enhancer binding factor 2, 45kDa
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant ILF2.
• Formulation: 50% glycerol
• Gene: ILF2
• Gene Accession No.: NM_004515
• Gene Alias: MGC8391/NF45/PRO3063
• Gene Symbols: ILF2
• Host Species: Mouse
• Immunogen: ILF2 (NP_004506, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 3608
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum