interleukin enhancer binding factor 2, 45kDa, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant ILF2.

Supplier:  Abnova Corporation H00003608A01

Catalog No. 89-004-168

Description

Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45kDa and 90kDa proteins, the smaller of which is the product of this gene. The encoded protein binds strongly to the 90kDa protein and stimulates its ability to enhance gene expression. [provided by RefSeq

Sequence: PSEVLTMLTNETGFEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGH

Specifications

• Antigen: interleukin enhancer binding factor 2, 45kDa
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant ILF2.
• Gene: ILF2
• Gene Alias: MGC8391/NF45/PRO3063
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Transcription Regulation
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004515
• Gene Symbols: ILF2
• Immunogen: ILF2 (NP_004506, 151 a.a. ∼ 250 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 3608
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.