interleukin-1 receptor-associated kinase 4, Mouse, Clone: 2D3, Abnova™

Catalog No.	Quantity
89-001-274	100 μg

Catalog No. 89-001-274 Supplier Abnova Corporation Supplier No. H00051135M04

Description

Mouse monoclonal antibody raised against a partial recombinant IRAK4.

This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. [supplied by RefSeq

Sequence: MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSELLFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDK

Specifications

• Antigen: interleukin-1 receptor-associated kinase 4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant IRAK4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: IRAK4
• Gene Accession No.: BC013316
• Gene Alias: IPD1/NY-REN-64/REN64
• Gene Symbols: IRAK4
• Host Species: Mouse
• Immunogen: IRAK4 (AAH13316, 1 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51135
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ