mitogen-activated protein kinase-activated protein kinase 2, Mouse, Clone: 3B8, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant MAPKAPK2.

Supplier:  Abnova Corporation H00009261M08

Catalog No. 89-001-123

Description

This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV

Specifications

• Antigen: mitogen-activated protein kinase-activated protein kinase 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_032960
• Gene Symbols: MAPKAPK2
• Immunogen: MAPKAPK2 (NP_116584, 266 a.a. ∼ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Clone: 3B8
• Description: Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2.
• Gene: MAPKAPK2
• Gene Alias: MK2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9261
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ