mitogen-activated protein kinase-activated protein kinase 2, Mouse, Clone: 3B8, Abnova™

Catalog No.	Quantity
89-001-123	100 μg

Catalog No. 89-001-123 Supplier Abnova Corporation Supplier No. H00009261M08

Description

Mouse monoclonal antibody raised against a full-length recombinant MAPKAPK2.

This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq

Sequence: NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV

Specifications

• Antigen: mitogen-activated protein kinase-activated protein kinase 2
• Applications: ELISA, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3B8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant MAPKAPK2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: MAPKAPK2
• Gene Accession No.: NM_032960
• Gene Alias: MK2
• Gene Symbols: MAPKAPK2
• Host Species: Mouse
• Immunogen: MAPKAPK2 (NP_116584, 266 a.a. ∼ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Kinases
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 9261
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ