Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89000988

NIMA (never in mitosis gene a)-related kinase 4, Mouse, Clone: 2E9, Abnova™

Catalog No. 89000988 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-988 50 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-988 Supplier Abnova Corporation Supplier No. H00006787M02
Only null left
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant NEK4.

Sequence: DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF

Specifications

Antigen NIMA (never in mitosis gene a)-related kinase 4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2E9
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant NEK4.
Formulation PBS with no preservative; pH 7.4
Gene NEK4
Gene Accession No. BC063044
Gene Alias MGC33171/NRK2/STK2/pp12301
Gene Symbols NEK4
Host Species Mouse
Immunogen NEK4 (AAH63044, 680 a.a. ∼ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Cell Cycle
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6787
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.