NIMA (never in mitosis gene a)-related kinase 4, Mouse, Clone: 2E9, Abnova™

Mouse monoclonal antibody raised against a partial recombinant NEK4.

Supplier:  Abnova Corporation H00006787M02

Catalog No. 89-000-988

Description

Sequence: DVPVANPVSEFKLHRKYRDTLILHGKVAEEAEEIHFKELPSAIMPGSEKIRRLVEVLRTDVIRGLGVQLLEQVYDLLEEEDEFDREVSVSLTVSRCLCYRIF

Specifications

• Antigen: NIMA (never in mitosis gene a)-related kinase 4
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC063044
• Gene Symbols: NEK4
• Immunogen: NEK4 (AAH63044, 680 a.a. ∼ 781 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 50 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2E9
• Description: Mouse monoclonal antibody raised against a partial recombinant NEK4.
• Gene: NEK4
• Gene Alias: MGC33171/NRK2/STK2/pp12301
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 6787
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ