nonmetastatic cells 2, protein (NM23B) expressed in, Mouse, Clone: 1D3, Abnova™

Catalog No.	Quantity
89-000-842	100 μg

Catalog No. 89-000-842 Supplier Abnova Corporation Supplier No. H00004831M06

Description

Mouse monoclonal antibody raised against a partial recombinant NME2.

Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product. [provided by RefSeq]

Sequence: HYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Specifications

• Antigen: non-metastatic cells 2, protein (NM23B) expressed in
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 1D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant NME2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: NME2
• Gene Accession No.: NM_002512
• Gene Alias: MGC111212/NDPK-B/NDPKB/NM23-H2/NM23B/puf
• Gene Symbols: NME2
• Host Species: Mouse
• Immunogen: NME2 (NP_002503, 51 a.a. ∼ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Cell Cycle
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4831
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG3 κ