Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NT2NL Antibody, Novus Biologicals™

Name: NT2NL Antibody, Novus Biologicals&trade;
Brand: Novus Biologicals
SKU: NBP198582
Price: 482.50 USD

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP198582

View more versions of this product

Catalog No. NBP198582

$482.50 / Each of 1

Qty

Add to Cart

Description

NT2NL Polyclonal specifically detects NT2NL in Human samples. It is validated for Western Blot.

Specifications

Antigen	NT2NL
Classification	Polyclonal
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	FLJ35032, FLJ55807, N2NNotch homolog 2 (Drosophila) N-terminal like, notch 2 N-terminal like, Notch homolog 2 N-terminal like protein, notch homolog 2 N-terminal-like protein
Host Species	Rabbit
Molecular Weight of Antigen	26 kDa
Quantity	100 μL
Research Discipline	Growth and Development, Neuronal Cell Markers
Gene ID (Entrez)	388677
Target Species	Human
Isotype	IgG

Applications	Western Blot
Concentration	0.5 mg/ml
Dilution	Western Blot 1.0 ug/ml
Gene Accession No.	NP_982283
Gene Symbols	NOTCH2NL
Immunogen	The immunogen for this antibody is NT2NL - C-terminal region. Peptide sequence LYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGK.
Purification Method	Affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Reconstitution	Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

Full Name:

Email Address:*

User Name:

Telephone Number:

What type of issue did you experience with the content on the page?*

Please provide a detailed description of the issue or request*

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Spot an opportunity for improvement?

Provide Content Correction

NT2NL Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions