NT2NL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP198582

Catalog No. NBP198582

Description

NT2NL Polyclonal specifically detects NT2NL in Human samples. It is validated for Western Blot.

Specifications

• Antigen: NT2NL
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ35032, FLJ55807, N2NNotch homolog 2 (Drosophila) N-terminal like, notch 2 N-terminal like, Notch homolog 2 N-terminal like protein, notch homolog 2 N-terminal-like protein
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Research Discipline: Growth and Development, Neuronal Cell Markers
• Gene ID (Entrez): 388677
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_982283
• Gene Symbols: NOTCH2NL
• Immunogen: The immunogen for this antibody is NT2NL - C-terminal region. Peptide sequence LYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.