Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
NT2NL Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | NT2NL |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP19858220
|
Novus Biologicals
NBP19858220UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP198582
|
Novus Biologicals
NBP198582 |
100 μL |
Each for $487.50
|
|
|||||
Description
NT2NL Polyclonal specifically detects NT2NL in Human samples. It is validated for Western Blot.Specifications
| NT2NL | |
| Polyclonal | |
| Rabbit | |
| Growth and Development, Neuronal Cell Markers | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ35032, FLJ55807, N2NNotch homolog 2 (Drosophila) N-terminal like, notch 2 N-terminal like, Notch homolog 2 N-terminal like protein, notch homolog 2 N-terminal-like protein | |
| NOTCH2NL | |
| IgG | |
| Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution. | |
| 26 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Human | |
| NP_982283 | |
| 388677 | |
| The immunogen for this antibody is NT2NL - C-terminal region. Peptide sequence LYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGK. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title