Parkinson disease (autosomal recessive, early onset) 7 (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-542	50 μL

Catalog No. 89-004-542 Supplier Abnova Corporation Supplier No. H00011315A01

Description

Mouse polyclonal antibody raised against a partial recombinant PARK7.

The product of this gene belongs to the peptidase C56 family of proteins. It acts as a positive regulator of androgen receptor-dependent transcription. It may also function as a redox-sensitive chaperone, as a sensor for oxidative stress, and it apparently protects neurons against oxidative stress and cell death. Defects in this gene are the cause of autosomal recessive early-onset Parkinson disease 7. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq

Sequence: MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG

Specifications

• Antigen: Parkinson disease (autosomal recessive, early onset) 7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant PARK7.
• Formulation: 50% glycerol
• Gene: PARK7
• Gene Accession No.: BC008188
• Gene Alias: DJ-1/DJ1/FLJ27376/FLJ34360/FLJ92274
• Gene Symbols: PARK7
• Host Species: Mouse
• Immunogen: PARK7 (AAH08188, 1 a.a. ∼ 100 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11315
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum