anti-PIEZO2, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP189892

Catalog No. NBP189892

Description

PIEZO2 Polyclonal specifically detects PIEZO2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PIEZO2
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: C18orf30, C18orf58, FAM38B, FAM38B2, family with sequence similarity 38, member B, family with sequence similarity 38, member B2, FLJ23144, FLJ23403, FLJ25916, FLJ34907, FLJ37734, FLJ45725, HsT748, HsT771, piezo-type mechanosensitive ion channel component 2, protein PIEZO2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PIEZO2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KPVTDEAAQSNPEFENEELAEGEKIDSEEALIYEEDFNGGDGVEGELEESTKLKMFRRLASVASKLK
• Quantity: 0.1 mL
• Research Discipline: Alzheimers Research, Neuroscience
• Gene ID (Entrez): 63895
• Target Species: Human
• Isotype: IgG

For Research Use Only