serum/glucocorticoid regulated kinase 1, Mouse, Clone: 3E3, Abnova™

Catalog No.	Quantity
89-000-963	100 μg

Catalog No. 89-000-963 Supplier Abnova Corporation Supplier No. H00006446M02

Description

Mouse monoclonal antibody raised against a partial recombinant SGK.

This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq

Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN

Specifications

• Antigen: serum/glucocorticoid regulated kinase 1
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 3E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant SGK.
• Formulation: PBS with no preservative; pH 7.4
• Gene: SGK1
• Gene Accession No.: BC001263
• Gene Alias: SGK
• Gene Symbols: SGK1
• Host Species: Mouse
• Immunogen: SGK (AAH01263, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6446
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ