Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

serum/glucocorticoid regulated kinase 1, Mouse, Clone: 3E3, Abnova™

Catalog No. 89000963 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-963 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-963 Supplier Abnova Corporation Supplier No. H00006446M02
Only null left
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant SGK.

This gene encodes a serine/threonine protein kinase that plays an important role in cellular stress response. This kinase activates certain potassium, sodium, and chloride channels, suggesting an involvement in the regulation of processes such as cell survival, neuronal excitability, and renal sodium excretion. High levels of expression of this gene may contribute to conditions such as hypertension and diabetic nephropathy. Several alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq

Sequence: MTVKTEAAKGTLTYSRMRGMVAILIAFMKQRRMGLNDFIQKIANNSYACKHPEVQSILKISQPQEPELMNANPSPPPSPSQQINLGPSSN

Specifications

Antigen serum/glucocorticoid regulated kinase 1
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 3E3
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant SGK.
Formulation PBS with no preservative; pH 7.4
Gene SGK1
Gene Accession No. BC001263
Gene Alias SGK
Gene Symbols SGK1
Host Species Mouse
Immunogen SGK (AAH01263, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 6446
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.