Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC23A2 Rabbit anti-Human, Mouse, Rat, Polyclonal, Novus Biologicals™
SDP

Catalog No. NBP213319 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP213319 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP213319 Supplier Novus Biologicals Supplier No. NBP213319

Rabbit Polyclonal Antibody has been used in 3 publications

SLC23A2 Polyclonal specifically detects SLC23A2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC23A2
Applications Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias KIAA0238SLC23A1, Na(+)/L-ascorbic acid transporter 2, Nucleobase transporter-like 1 protein, Sodium-dependent vitamin C transporter 2, sodium-dependent vitamin C transporter-2, solute carrier family 23 (nucleobase transporters), member 1, solute carrier family 23 (nucleobase transporters), member 2, solute carrier family 23 member 2, SVCT2NBTL1, Yolk sac permease-like molecule 2, YSPL2hSVCT2
Gene Symbols SLC23A2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: DKWKCNTTDVSVANGTAELLHTEHIWYPRI
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9962
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.