T, brachyury homolog (mouse), Mouse, Clone: 5C5, Abnova™

Catalog No.	Quantity
89-000-995	100 μg

Catalog No. 89-000-995 Supplier Abnova Corporation Supplier No. H00006862M02

Description

Mouse monoclonal antibody raised against a partial recombinant T.

The protein encoded by this gene is an embryonic nuclear transcription factor that binds to a specific DNA element, the palindromic T-site. It binds through a region in its N-terminus, called the T-box, and effects transcription of genes required for mesoderm formation and differentiation. The protein is localized to notochord-derived cells. [provided by RefSeq

Sequence: ERSDHKEMMEEPGDSQQPGYSQWGWLLPGTSTLCPPANPHPQFGGALSLPSTHSCDRYPTLRSHRSSPYPSPYAHRNNSPTYSDNSPACLSMLQSHDNW

Specifications

• Antigen: T, brachyury homolog (mouse)
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5C5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant T.
• Formulation: PBS with no preservative; pH 7.4
• Gene: T
• Gene Accession No.: NM_003181
• Gene Alias: MGC104817/TFT
• Gene Symbols: T
• Host Species: Mouse
• Immunogen: T (NP_003172, 222 a.a. ∼ 320 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 6862
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ