anti-USP38, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213510

Catalog No. NBP213510

Description

USP38 Polyclonal specifically detects USP38 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: USP38
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: Deubiquitinating enzyme 38, EC 3.4.19.12, HP43.8KDFLJ35970, KIAA1891ubiquitin specific protease 38, ubiquitin carboxyl-terminal hydrolase 38, ubiquitin specific peptidase 38, ubiquitin thioesterase 38, Ubiquitin thiolesterase 38, Ubiquitin-specific-processing protease 38
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84640
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: USP38
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: YSYARNITSTDSSYQMYHQSEALALASSQSHLLGRDSPSAVFEQDLENKE MSKEWFLFNDSRVTFTSFQSVQ
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only