Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. AP-2 beta/TFAP2B Antibody, Novus Biologicals™

AP-2 beta/TFAP2B Antibody, Novus Biologicals™
SDP

Catalog No. NB430943 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430943 25 μL
NBP189063 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430943 Supplier Novus Biologicals Supplier No. NBP18906325UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

AP-2 beta/TFAP2B Polyclonal specifically detects AP-2 beta/TFAP2B in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen AP-2 beta/TFAP2B
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias activating enhancer binding protein 2 beta, Activating enhancer-binding protein 2-beta, AP-2B, AP2-B, AP2-beta, CHAR, MGC21381, transcription factor AP-2 beta (activating enhancer binding protein 2 beta), transcription factor AP-2 beta (activating enhancer-binding protein 2 beta), transcription factor AP-2-beta
Gene Symbols TFAP2B
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 7021
Test Specificity Specificity of human AP-2 beta/TFAP2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.