Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP-2 beta/TFAP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP189063
Description
AP-2 beta/TFAP2B Polyclonal specifically detects AP-2 beta/TFAP2B in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
AP-2 beta/TFAP2B | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
activating enhancer binding protein 2 beta, Activating enhancer-binding protein 2-beta, AP-2B, AP2-B, AP2-beta, CHAR, MGC21381, transcription factor AP-2 beta (activating enhancer binding protein 2 beta), transcription factor AP-2 beta (activating enhancer-binding protein 2 beta), transcription factor AP-2-beta | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of human AP-2 beta/TFAP2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
TFAP2B | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG | |
0.1 mL | |
Neuroscience | |
7021 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction