Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP-2 beta/TFAP2B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $648.50
Specifications
Antigen | AP-2 beta/TFAP2B |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
AP-2 beta/TFAP2B Polyclonal specifically detects AP-2 beta/TFAP2B in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
AP-2 beta/TFAP2B | |
Polyclonal | |
Rabbit | |
Neuroscience | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
7021 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:QRQRQEVGSEAGSLLPQPRAALPQLSGLDPRRDYHSVRRPDVLLHSAHHGLDAGMG | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
activating enhancer binding protein 2 beta, Activating enhancer-binding protein 2-beta, AP-2B, AP2-B, AP2-beta, CHAR, MGC21381, transcription factor AP-2 beta (activating enhancer binding protein 2 beta), transcription factor AP-2 beta (activating enhancer-binding protein 2 beta), transcription factor AP-2-beta | |
TFAP2B | |
IgG | |
Affinity Purified | |
Specificity of human AP-2 beta/TFAP2B antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title