Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

AP1M2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15703520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15703520 20 μL
NBP157035 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15703520 Supplier Novus Biologicals Supplier No. NBP15703520UL

Rabbit Polyclonal Antibody

AP1M2 Polyclonal specifically detects AP1M2 in Human samples. It is validated for Western Blot.

Specifications

Antigen AP1M2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9Y6Q5
Gene Alias Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2
Gene Symbols AP1M2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to AP1M2 (adaptor-related protein complex 1, mu 2 subunit) The peptide sequence was selected from the N terminal of AP1M2 (NP_005489). Peptide sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLL.
Molecular Weight of Antigen 48 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 10053
Test Specificity This product is specific to Subunit or Isoform: mu-2.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.