AP2M1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255860

Catalog No. NBP255860

Description

AP2M1 Polyclonal specifically detects AP2M1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: AP2M1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Adaptin-mu2, adaptor-related protein complex 2, mu 1 subunit, AP-2 mu chain, Clathrin assembly protein complex 2 medium chain, clathrin coat adaptor protein AP50, Clathrin coat assembly protein AP50, Clathrin coat-associated protein AP50, clathrin-associated/assembly/adaptor protein, medium 1, HA2 50 kDa subunit, KIAA0109, mu subunit, Plasma membrane adaptor AP-2 50 kDa protein, plasma membrane adaptor AP-2 50kDA protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: AP2M1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFGMNDKIVIEKQGKGTADETSKSGKQSIAIDDCTF
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 1173
• Target Species: Human
• Isotype: IgG

For Research Use Only