AP3B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP168927

Catalog No. NBP168927

Description

AP3B1 Polyclonal specifically detects AP3B1 in Rat samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: AP3B1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: AP3B1
• Immunogen: Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8546
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Alias: Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, adaptor-related protein complex 3, beta 1 subunit, ADTB3, ADTB3APE, AP-3 complex subunit beta-1, beta-3A-adaptin, beta3A-adaptin, Clathrin assembly protein complex 3 beta-1 large chain, HPS, HPS2AP-3 complex beta-3A subunit
• Host Species: Rabbit
• Molecular Weight of Antigen: 121 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to AP3B1.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine
• Isotype: IgG