Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP3B1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | AP3B1 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP168927
|
Novus Biologicals
NBP168927 |
100 μL |
Each for $487.50
|
|
|||||
|
NBP16892720
|
Novus Biologicals
NBP16892720UL |
20 μL | N/A | N/A | N/A | ||||
Description
AP3B1 Polyclonal specifically detects AP3B1 in Rat samples. It is validated for Western Blot, Immunoprecipitation.Specifications
| AP3B1 | |
| Unconjugated | |
| RUO | |
| 8546 | |
| Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM. | |
| Primary | |
| 121 kDa |
| Polyclonal | |
| Rabbit | |
| Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, adaptor-related protein complex 3, beta 1 subunit, ADTB3, ADTB3APE, AP-3 complex subunit beta-1, beta-3A-adaptin, beta3A-adaptin, Clathrin assembly protein complex 3 beta-1 large chain, HPS, HPS2AP-3 complex beta-3A subunit | |
| AP3B1 | |
| IgG | |
| This product is specific to AP3B1. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title