AP3B1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP16892720UL

Catalog No. NBP16892720

Description

AP3B1 Polyclonal specifically detects AP3B1 in Rat samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: AP3B1
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Alias: Adapter-related protein complex 3 subunit beta-1, Adaptor protein complex AP-3 subunit beta-1, adaptor-related protein complex 3, beta 1 subunit, ADTB3, ADTB3APE, AP-3 complex subunit beta-1, beta-3A-adaptin, beta3A-adaptin, Clathrin assembly protein complex 3 beta-1 large chain, HPS, HPS2AP-3 complex beta-3A subunit
• Host Species: Rabbit
• Molecular Weight of Antigen: 121 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to AP3B1.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS & 2% Sucrose. with No Preservative
• Gene Symbols: AP3B1
• Immunogen: Synthetic peptides corresponding to Ap3b1 (adaptor-related protein complex 3, beta 1 subunit) The peptide sequence was selected from the N terminal of Ap3b1. Peptide sequence MSSNSFAYNEQSGGGEAAELGQEATSTISSSGAFGLFSSDWKKNEDLKQM.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8546
• Target Species: Rat
• Isotype: IgG