Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP4M1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310704100UL
Description
AP4M1 Polyclonal specifically detects AP4M1 in Human samples. It is validated for Western Blot.Specifications
AP4M1 | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
Adapter-related protein complex 4 mu-1 subunit, adaptor-related protein complex 4, mu 1 subunit, adaptor-related protein complex AP-4 mu4 subunit, AP-4 adapter complex mu subunit, AP-4 complex subunit mu-1, CPSQ3, Mu subunit of AP-4, mu4, MU-4, Mu4-adaptin, Mu-adaptin-related protein 2, mu-adaptin-related protein-2, MUARP2, MU-ARP2 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP4M1 (NP_004713). Peptide sequence QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS | |
100 μg | |
Primary | |
Human | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
9179 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction