Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AP4M1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | AP4M1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
AP4M1 Polyclonal specifically detects AP4M1 in Human samples. It is validated for Western Blot.Specifications
| AP4M1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| Adapter-related protein complex 4 mu-1 subunit, adaptor-related protein complex 4, mu 1 subunit, adaptor-related protein complex AP-4 mu4 subunit, AP-4 adapter complex mu subunit, AP-4 complex subunit mu-1, CPSQ3, Mu subunit of AP-4, mu4, MU-4, Mu4-adaptin, Mu-adaptin-related protein 2, mu-adaptin-related protein-2, MUARP2, MU-ARP2 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human AP4M1 (NP_004713). Peptide sequence QELSSPEQKAELAEGALRWDLPRVQGGSQLSGLFQMDVPGPPGPPSHGLS | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 9179 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title