APBA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256155

Catalog No. NBP256155

Description

APBA1 Polyclonal specifically detects APBA1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: APBA1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Adapter protein X11alpha, amyloid beta (A4) precursor protein-binding, family A, member 1, amyloid beta A4 precursor protein-binding family A member 1, D9S411Eadaptor protein X11alpha, LIN10, Mint-1, MINT1amyloid beta (A4) precursor protein-binding, family A, member 1 (X11), Neuronal Munc18-1-interacting protein 1, Neuron-specific X11 protein, phosphotyrosine-binding/-interacting domain (PTB)-bearing protein, UROP11, X11A, X11X11ALPHA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: APBA1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ALPNHLHFHSLEHEEAMNAAYSGYVYTHRLFHRGEDEPYSEPYADYGGLQEHVYEEIGDAPELDARDGLRLYEQERDE
• Quantity: 100 μL
• Research Discipline: Membrane Trafficking and Chaperones, Vision
• Gene ID (Entrez): 320
• Target Species: Human
• Isotype: IgG

For Research Use Only