Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APE Antibody, Novus Biologicals™

APE Antibody, Novus Biologicals™
SDP

Catalog No. NBP254653 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP254653 100 μL
NB395313 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP254653 Supplier Novus Biologicals Supplier No. NBP254653
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

APE Polyclonal specifically detects APE in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen APE
Applications Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias AP endonuclease 1, APE, APE1, APE-1, APEAPEX nuclease (multifunctional DNA repair enzyme), APENAP endonuclease class I, APEX deoxyribonuclease (apurinic or apyrimidinic), APEX nuclease, APEX nuclease (multifunctional DNA repair enzyme) 1, Apurinic-apyrimidinic endonuclease 1, APXAP lyase, DNA-(apurinic or apyrimidinic site) lyase, EC 3.1, EC 4.2.99.18, HAP1apurinic/apyrimidinic (abasic) endonuclease, multifunctional DNA repair enzyme, protein REF-1, redox factor 1, Redox factor-1, REF-1, REF1 apurinic/apyrimidinic exonuclease
Gene Symbols APEX1
Host Species Rabbit
Immunogen This antibody was developed against a Recombinant Protein corresponding to amino acids:KLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLAD
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Autophagy, Base Excision Repair, Cancer, Core ESC Like Genes, DNA Repair, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 328
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.