Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16894620

APJ/Apelin receptor Antibody, Novus Biologicals™
SDP

Catalog No. NBP16894620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16894620 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16894620 Supplier Novus Biologicals Supplier No. NBP16894620UL

Description

Rabbit Polyclonal Antibody

APJ/Apelin receptor Polyclonal specifically detects APJ/Apelin receptor in Human samples. It is validated for Western Blot.

Specifications

Antigen APJ/Apelin receptor
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P35414
Gene Alias AGTRL1HG11, angiotensin II receptor-like 1, Angiotensin receptor-like 1, apelin receptor, APJ (apelin) receptor, APJ receptor, APJFLJ96609, APJR, FLJ90771, G protein-coupled receptor APJ, G-protein coupled receptor APJ, G-protein coupled receptor HG11, HG11 orphan receptor, MGC45246
Gene Symbols APLNR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to APLNR (apelin receptor) The peptide sequence was selected form the N terminal of APLNR. Peptide sequence NGLVLWTVFRSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYRDYDW.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline GPCR
Primary or Secondary Primary
Gene ID (Entrez) 187
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.