Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APLF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18680625UL
Description
APLF Polyclonal specifically detects APLF in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
APLF | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q8IW19 | |
APLF | |
This antibody was developed against Recombinant Protein corresponding to amino acids:NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV | |
Affinity Purified | |
RUO | |
200558 | |
Human | |
IgG |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
APFL, aprataxin- and PNK-like factor, aprataxin and PNK-like factor, aprataxin and PNKP like factor, Apurinic-apyrimidinic endonuclease APLF, C2orf13FLJ16593, chromosome 2 open reading frame 13, EC 4.2.99.18, MGC47799, PALF, PNK and APTX-like FHA domain-containing protein, PNK and APTX-like FHA protein, Xip1, XRCC1-interacting protein 1 | |
Rabbit | |
57 kDa | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction