Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APLF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	APLF
Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB431684 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18680625UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP186806 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP186806	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

APLF Polyclonal specifically detects APLF in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	APLF
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Accession No.	Q8IW19
Gene ID (Entrez)	200558
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:NKVKRTSCMYGANCYRKNPVHFQHFSHPGDSDYGGVQIVGQDETDDRPECPYGPSCYRKNPQHKIEYRHNTLPVRNV
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Molecular Weight of Antigen	57 kDa

Dilution	Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	APFL, aprataxin- and PNK-like factor, aprataxin and PNK-like factor, aprataxin and PNKP like factor, Apurinic-apyrimidinic endonuclease APLF, C2orf13FLJ16593, chromosome 2 open reading frame 13, EC 4.2.99.18, MGC47799, PALF, PNK and APTX-like FHA domain-containing protein, PNK and APTX-like FHA protein, Xip1, XRCC1-interacting protein 1
Gene Symbols	APLF
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

APLF Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents