APLF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23821225UL

Catalog No. NB396933

Description

APLF Polyclonal specifically detects APLF in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: APLF
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q8IW19
• Gene Symbols: APLF
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SQLEGSTEIAKTQMTPTNSVSFLGENRDCNKQQPILAERKRILPTWMLAEHLSDQNLSVPAISGGNVIQGSGKEEICKDKSQLN
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: APFL, aprataxin- and PNK-like factor, aprataxin and PNK-like factor, aprataxin and PNKP like factor, Apurinic-apyrimidinic endonuclease APLF, C2orf13FLJ16593, chromosome 2 open reading frame 13, EC 4.2.99.18, MGC47799, PALF, PNK and APTX-like FHA domain-containing protein, PNK and APTX-like FHA protein, Xip1, XRCC1-interacting protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200558
• Target Species: Human
• Isotype: IgG