Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APMAP Antibody, Novus Biologicals™
SDP

Catalog No. NBP15998420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15998420 20 μL
NBP159984 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15998420 Supplier Novus Biologicals Supplier No. NBP15998420UL

Rabbit Polyclonal Antibody

APMAP Polyclonal specifically detects APMAP in Human samples. It is validated for Western Blot.

Specifications

Antigen APMAP
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.25 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9HDC9
Gene Alias adipocyte plasma membrane-associated protein, APMAP, BSCv, chromosome 20 open reading frame 3, Protein BSCv
Gene Symbols APMAP
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C20ORF3 The peptide sequence was selected from the C terminal of C20ORF3 (NP_065392). Peptide sequence QETVMKFVPRYSLVLELSDSGAFRRSLHDPDGLVATYISEVHEHDGHLYL.
Molecular Weight of Antigen 46 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 57136
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.