Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APOBEC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP157268
Description
APOBEC1 Polyclonal specifically detects APOBEC1 in Human samples. It is validated for Western Blot.Specifications
APOBEC1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
APOBEC-1, apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1, Apolipoprotein B mRNA-editing enzyme 1, BEDPC->U-editing enzyme APOBEC-1, CDAR1, EC 3.5.4, EC 3.5.4.-, HEPRapolipoprotein B mRNA editing enzyme complex-1 | |
Rabbit | |
Affinity purified | |
RUO | |
339 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
P41238 | |
APOBEC1 | |
Synthetic peptides corresponding to APOBEC1(apolipoprotein B mRNA editing enzyme, catalytic polypeptide 1) The peptide sequence was selected from the N terminal of APOBEC1. Peptide sequence TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Mouse: 85%; Pig: 85%; Canine: 78%; Equine: 78%. | |
Human, Mouse, Rat, Pig, Canine, Equine, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction