Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP157516

APOBEC3B Antibody, Novus Biologicals™
SDP

Catalog No. NBP157516 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157516 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157516 Supplier Novus Biologicals Supplier No. NBP157516
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

APOBEC3B Polyclonal specifically detects APOBEC3B in Human samples. It is validated for Western Blot.

Specifications

Antigen APOBEC3B
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9UH17
Gene Alias APOBEC1L, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B, ARCD3, ARP4, bK150C2.2, cytidine deaminase, DJ742C19.2, EC 3.5.4, EC 3.5.4.-, FLJ21201, phorbolin 3, Phorbolin-1-related protein, phorbolin-2/3, PHRBNLphorbolin 2, probable DNA dC->dU-editing enzyme APOBEC-3B
Gene Symbols APOBEC3B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to APOBEC3B(apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3B) The peptide sequence was selected from the N terminal of APOBEC3B (NP_004891). Peptide sequence: NQLPAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYW The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 46 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9582
Reconstitution Centrifuge vial prior to reconstitution. Add 50μL distilled water to a final antibody concentration of 1mg/mL.
Target Species Human, Rat, Pig, Bovine, Equine, Rabbit, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.