Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

APOBEC3G Antibody, Novus Biologicals™
SDP

Catalog No. NBP158955 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158955 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158955 Supplier Novus Biologicals Supplier No. NBP158955
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

APOBEC3G Polyclonal specifically detects APOBEC3G in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen APOBEC3G
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Alias APOBEC-related cytidine deaminase, APOBEC-related protein, APOBEC-related protein 9, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G, ARCD, ARP-9, bK150C2.7, CEM-15, CEM15ARP9, dJ494G10.1, DNA dC->dU-editing enzyme APOBEC-3G, EC 3.5.4, EC 3.5.4.-, EC 3.5.4.5, FLJ12740DNA dC->dU editing enzyme, MDS019, phorbolin-like protein MDS019
Gene Symbols APOBEC3G
Host Species Rabbit
Immunogen Synthetic peptides corresponding to APOBEC3G (apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3G) The peptide sequence was selected from the N terminal of APOBEC3G. Peptide sequence AKIFRGQVYSELKYHPEMRFFHWFSKWRKLHRDQEYEVTWYISWSPCTKC The peptide sequence for this immunogen was taken from within the described region.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 60489
Test Specificity Expected identity based on immunogen sequence: Human: 100%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.