Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Apolipoprotein A-II/ApoA2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15771620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15771620 20 μL
NBP157716 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15771620 Supplier Novus Biologicals Supplier No. NBP15771620UL

Rabbit Polyclonal Antibody

Apolipoprotein A-II/ApoA2 Polyclonal specifically detects Apolipoprotein A-II/ApoA2 in Human samples. It is validated for Western Blot.

Specifications

Antigen Apolipoprotein A-II/ApoA2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P02652
Gene Alias APOA2, apoAII, Apo-AII, ApoA-II, Apolipoprotein A2, apolipoprotein A-II
Gene Symbols APOA2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to APOA2 (apolipoprotein A-II) The peptide sequence was selected from the N terminal of APOA2)(50ug). Peptide sequence MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME.
Molecular Weight of Antigen 9 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Cancer, Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 336
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.