Apolipoprotein H/ApoH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156310

Catalog No. NBP156310

Description

Apolipoprotein H/ApoH Polyclonal specifically detects Apolipoprotein H/ApoH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Apolipoprotein H/ApoH
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Activated protein C-binding protein, Anticardiolipin cofactor, APC inhibitor, Apo-H, Apolipoprotein H, apolipoprotein H (beta-2-glycoprotein I), B2G1, B2GP1, B2GPI, Beta(2)GPI, beta-2-glycoprotein 1, Beta-2-glycoprotein I, BG
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Guinea pig: 85%; Mouse: 85%; Rabbit: 78%.
• Target Species: Human, Mouse, Rat, Pig, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P02749
• Gene Symbols: APOH
• Immunogen: Synthetic peptides corresponding to APOH(apolipoprotein H (beta-2-glycoprotein I)) The peptide sequence was selected from the middle region of APOH. Peptide sequence PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG.
• Quantity: 100 μL
• Research Discipline: Cholesterol Metabolism, Lipid and Metabolism
• Gene ID (Entrez): 350
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.