Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Apolipoprotein H/ApoH Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Apolipoprotein H/ApoH |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Apolipoprotein H/ApoH Polyclonal specifically detects Apolipoprotein H/ApoH in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
Apolipoprotein H/ApoH | |
Polyclonal | |
Rabbit | |
Cholesterol Metabolism, Lipid and Metabolism | |
Activated protein C-binding protein, Anticardiolipin cofactor, APC inhibitor, Apo-H, Apolipoprotein H, apolipoprotein H (beta-2-glycoprotein I), B2G1, B2GP1, B2GPI, Beta(2)GPI, beta-2-glycoprotein 1, Beta-2-glycoprotein I, BG | |
APOH | |
IgG |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
P02749 | |
350 | |
Synthetic peptides corresponding to APOH(apolipoprotein H (beta-2-glycoprotein I)) The peptide sequence was selected from the middle region of APOH. Peptide sequence PPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHG. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title