APPD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179945

Catalog No. NBP179945

Description

APPD Polyclonal specifically detects APPD in Human samples. It is validated for Western Blot.

Specifications

• Antigen: APPD
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Apoptosis-inducing protein, APPDapoptosis-inducing protein D, LAPF, Lysosome-associated apoptosis-inducing protein containing PH and FYVE domains, MGC4090, PH and FYVE domain-containing protein 1, PH domain-containing family F member 1, phafin-1, PHAFIN1, pleckstrin homology domain containing, family F (with FYVE domain) member 1, pleckstrin homology domain-containing family F member 1, ZFYVE15phafin 1, Zinc finger FYVE domain-containing protein 15
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%Yeast: 100%; Trypanosoma brucei: 100%; Trypanosoma brucei gambiense DAL972: 100%; Bovine: 92%; Canine: 92%; Mouse: 92%; Rat: 92%; Roseovarius sp. TM1035: 91%; Candida lipolytica: 90%; Brown alga: 90%; Phytophthora infestans T30-4: 90%; Erythrobacter sp. SD-21: 90%; Aspergillus clavatus: 83%; Caenorhabditis vulgaris: 83%; Xenopus: 83%; Fruit fly: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Yeast
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_077286
• Gene Symbols: PLEKHF1
• Immunogen: Synthetic peptide directed towards the C terminal of human APPDThe immunogen for this antibody is APPD. Peptide sequence QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79156
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG