Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APPD Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | APPD |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
APPD Polyclonal specifically detects APPD in Human samples. It is validated for Western Blot.Specifications
| APPD | |
| Polyclonal | |
| Purified | |
| RUO | |
| Apoptosis-inducing protein, APPDapoptosis-inducing protein D, LAPF, Lysosome-associated apoptosis-inducing protein containing PH and FYVE domains, MGC4090, PH and FYVE domain-containing protein 1, PH domain-containing family F member 1, phafin-1, PHAFIN1, pleckstrin homology domain containing, family F (with FYVE domain) member 1, pleckstrin homology domain-containing family F member 1, ZFYVE15phafin 1, Zinc finger FYVE domain-containing protein 15 | |
| PLEKHF1 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| NP_077286 | |
| 79156 | |
| Synthetic peptide directed towards the C terminal of human APPDThe immunogen for this antibody is APPD. Peptide sequence QPAHLARPICGASSGDDDDSDEDKEGSRDGDWPSSVEFYASGVAWSAFHS. | |
| Primary | |
| 31 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title