Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. APPL Antibody, Novus Biologicals™

APPL Antibody, Novus Biologicals™
SDP

Catalog No. NBP276565 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP276565 100 μL
NB392738 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP276565 Supplier Novus Biologicals Supplier No. NBP276565
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

APPL Polyclonal specifically detects APPL in Human samples. It is validated for Western Blot.

Specifications

Antigen APPL
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias Adapter protein containing PH domain, PTB domain and leucine zipper motif 1, adaptor protein containing pH domain, PTB domain and leucine zipper motif 1, adaptor protein, phosphotyrosine interaction, PH domain and leucine zippercontaining 1, AKT2 interactor, APPLdip13-alpha, DCC-interacting protein 13-alpha, DIP 13 alpha, DIP13A, Dip13-alpha, DIP13alpha, KIAA1428, signaling adaptor protein DIP13alpha
Gene Symbols APPL1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KIALLEPLLGYMQAQISFFKMGSENLNEQLEEFLANIGTSVQNVRREMDSDIETMQQTIEDLEVASDPLYVPDPDPTKFPVNR
Purification Method Affinity Purified
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 26060.0
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.