APR3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179969

Catalog No. NBP179969

Description

44289 Polyclonal specifically detects 44289 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: APR3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: apoptosis related protein 3, apoptosis related protein APR-3, apoptosis-related protein 3, APR3, APR-3, APR--3, chromosome 2 open reading frame 28, HSPC013, p18PRO240
• Host Species: Rabbit
• Molecular Weight of Antigen: 18 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 51374
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_057169
• Gene Symbols: ATRAID
• Immunogen: Synthetic peptide directed towards the C terminal of human C2orf28. Peptide sequence VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Porcine: 87%; Rat: 87%; Mouse: 87%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG