Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
APR3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | APR3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
44289 Polyclonal specifically detects 44289 in Human samples. It is validated for Western Blot.Specifications
APR3 | |
Polyclonal | |
Rabbit | |
Apoptosis | |
apoptosis related protein 3, apoptosis related protein APR-3, apoptosis-related protein 3, APR3, APR-3, APR--3, chromosome 2 open reading frame 28, HSPC013, p18PRO240 | |
ATRAID | |
IgG | |
18 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_057169 | |
51374 | |
Synthetic peptide directed towards the C terminal of human C2orf28. Peptide sequence VCADGFHGYKCMRQGSFSLLMFFGILGATTLSVSILLWATQRRKAKTS. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title