Aquaporin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 8 publications

Supplier:  Novus Biologicals NBP18767925UL

Catalog No. NB406003

Description

Aquaporin-4 Polyclonal specifically detects Aquaporin-4 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

• Antigen: Aquaporin-4
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25 - 2 ug/mL, Immunoprecipitation, Immunohistochemistry-Paraffin 1:2500 - 1:5000, Immunohistochemistry-Frozen
• Gene Accession No.: P55087
• Gene Symbols: AQP4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 361
• Target Species: Human, Mouse, Rat, Bovine
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: aquaporin 4, MGC22454
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human Aquaporin-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only