Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Aquaporin-4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 8 publications

$416.50 - $684.50

Specifications

Antigen	Aquaporin-4
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB406003 View Documents View Product Certificates	Novus Biologicals NBP18767925UL	25 μL	Each for $416.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP187679 View Documents View Product Certificates	Novus Biologicals NBP187679	0.1 mL	Each for $684.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

Aquaporin-4 Polyclonal specifically detects Aquaporin-4 in Human, Mouse, Rat, Bovine samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunoprecipitation, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.

Specifications

Antigen	Aquaporin-4
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human, Mouse, Rat, Bovine
Gene Accession No.	P55087
Gene ID (Entrez)	361
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Molecular Weight of Antigen	35 kDa

Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias	aquaporin 4, MGC22454
Gene Symbols	AQP4
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of human Aquaporin-4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Aquaporin-4 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents