Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aquaporin-7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15438420UL
Description
Aquaporin-7 Polyclonal specifically detects Aquaporin-7 in Human samples. It is validated for Western Blot.Specifications
Aquaporin-7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O14520 | |
AQP7 | |
Synthetic peptides corresponding to AQP7 (aquaporin 7) The peptide sequence was selected from the C terminal of AQP7. Peptide sequence DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA. | |
Affinity Purified | |
RUO | |
364 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
AQP-7, AQP7L, AQP9MGC149556, AQPapaquaglyceroporin-7, Aquaglyceroporin-7, aquaporin 7, Aquaporin adipose, aquaporin-7, Aquaporin-7-like, MGC149555 | |
Rabbit | |
37 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction