Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Aquaporin-7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | Aquaporin-7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP154384
|
Novus Biologicals
NBP154384 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP15438420
|
Novus Biologicals
NBP15438420UL |
20 μL | N/A | N/A | N/A | ||||
Description
Aquaporin-7 Polyclonal specifically detects Aquaporin-7 in Human samples. It is validated for Western Blot.Specifications
| Aquaporin-7 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AQP-7, AQP7L, AQP9MGC149556, AQPapaquaglyceroporin-7, Aquaglyceroporin-7, aquaporin 7, Aquaporin adipose, aquaporin-7, Aquaporin-7-like, MGC149555 | |
| AQP7 | |
| IgG | |
| 37 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| O14520 | |
| 364 | |
| Synthetic peptides corresponding to AQP7 (aquaporin 7) The peptide sequence was selected from the C terminal of AQP7. Peptide sequence DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title