Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25642925UL
Description
ARAP1 Polyclonal specifically detects ARAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
ARAP1 | |
Polyclonal | |
Western Blot 0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1, centaurin, delta 2, Centaurin-delta-2, CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containingprotein 1, cnt-d2, KIAA0782centaurin-delta-2 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ARAP1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK | |
25 μL | |
Cell Cycle and Replication | |
116985 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction