Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ARAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ARAP1 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ARAP1 Polyclonal specifically detects ARAP1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
ARAP1 | |
Polyclonal | |
Rabbit | |
Cell Cycle and Replication | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
116985 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLPSTIAAPHPMDGPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVACISHVAAIGDQKFEVITNNRTFAFRAESDVERK | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
arf-GAP with Rho-GAP domain, ANK repeat and PH domain-containing protein 1, ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 1, centaurin, delta 2, Centaurin-delta-2, CENTD2ARF-GAP, RHO-GAP, ankyrin repeat, and pleckstrin homology domains-containingprotein 1, cnt-d2, KIAA0782centaurin-delta-2 | |
ARAP1 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title