Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AREL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15939320UL
Description
AREL1 Polyclonal specifically detects AREL1 in Human samples. It is validated for Western Blot.Specifications
KIAA0317 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O15033 | |
KIAA0317 | |
Synthetic peptides corresponding to KIAA0317(KIAA0317) The peptide sequence was selected from the middle region of KIAA0317. Peptide sequence VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
hypothetical protein LOC9870, KIAA0317 | |
Rabbit | |
Affinity Purified | |
RUO | |
9870 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction