Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
AREL1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | KIAA0317 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15939320
|
Novus Biologicals
NBP15939320UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159393
|
Novus Biologicals
NBP159393 |
100 μL |
Each for $487.50
|
|
|||||
Description
AREL1 Polyclonal specifically detects AREL1 in Human samples. It is validated for Western Blot.Specifications
| KIAA0317 | |
| Polyclonal | |
| Rabbit | |
| O15033 | |
| 9870 | |
| Synthetic peptides corresponding to KIAA0317(KIAA0317) The peptide sequence was selected from the middle region of KIAA0317. Peptide sequence VRARFTRSFLAQIIGLRMHYKYFETDDPEFYKSKVCFILNNDMSEMELVF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hypothetical protein LOC9870, KIAA0317 | |
| KIAA0317 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title